For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    compcartilage-oligomeric-matrix-protein-antibody-ab171854.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Proteins Thrombospondin
Share by email

Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854)

    Key features and details

    • Mouse polyclonal to COMP/Cartilage oligomeric matrix protein
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant human COMP/Cartilage oligomeric matrix protein (Active) (ab174082)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-COMP/Cartilage oligomeric matrix protein antibody
      See all COMP/Cartilage oligomeric matrix protein primary antibodies
    • Description

      Mouse polyclonal to COMP/Cartilage oligomeric matrix protein
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat, Cow
    • Immunogen

      Recombinant full length protein corresponding to Human COMP/Cartilage oligomeric matrix protein aa 1-724. This sequence is a synthetic construct corresponding to aa 34-757 fragment of Human COMP/Cartilage oligomeric matrix protein according to Swissprot P49747.
      Sequence:

      MLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLP SVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNA HPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINE CETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGS PSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCP ERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRN PDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQ ADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSD QDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDN CRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRA FQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFE GTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEP GIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYR WFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENII WANLRYRCNDTIPEDYETHQLRQA


      Database link: ABM87644.1
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • COMP/Cartilage oligomeric matrix protein-transfected 293T cell lysate.
    • General notes

       This product was previously labelled as COMP

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.4
      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Cytoskeleton / ECM
      • Extracellular Matrix
      • ECM Proteins
      • Thrombospondin
      • Signal Transduction
      • Cytoskeleton / ECM
      • Extracellular Matrix
      • Structures
      • Bone
      • Cell Biology
      • Cell Cycle
      • Cell differentiation
      • Stem Cells
      • Mesenchymal Stem Cells
      • Chondrogenesis

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG - Isotype Control (ab37355)
    • Recombinant Protein

      • Recombinant human COMP/Cartilage oligomeric matrix protein (Active) (ab174082)

    Applications

    Our Abpromise guarantee covers the use of ab171854 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa.

    Target

    • Function

      May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7.
    • Tissue specificity

      Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect.
    • Involvement in disease

      Defects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1) [MIM:132400]. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
      Defects in COMP are the cause of pseudoachondroplasia (PSACH) [MIM:177170]. PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood.
    • Sequence similarities

      Belongs to the thrombospondin family.
      Contains 4 EGF-like domains.
      Contains 1 TSP C-terminal (TSPC) domain.
      Contains 8 TSP type-3 repeats.
    • Developmental stage

      Present during the earliest stages of limb maturation and is later found in regions where the joints develop.
    • Domain

      The cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.
      The TSP C-terminal domain mediates interaction with FN1 and ACAN.
    • Cellular localization

      Secreted > extracellular space > extracellular matrix.
    • Target information above from: UniProt accession P49747 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 281088 Cow
      • Entrez Gene: 1311 Human
      • Entrez Gene: 12845 Mouse
      • Entrez Gene: 25304 Rat
      • Omim: 600310 Human
      • SwissProt: P35445 Cow
      • SwissProt: P49747 Human
      • SwissProt: Q9R0G6 Mouse
      • SwissProt: P35444 Rat
      • Unigene: 1584 Human
      • Unigene: 45071 Mouse
      • Unigene: 10343 Rat
      see all
    • Alternative names

      • cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple) antibody
      • Cartilage oligomeric matrix protein antibody
      • Cartilage oligomeric matrix protein precursor antibody
      • COMP antibody
      • COMP_HUMAN antibody
      • EDM 1 antibody
      • EDM1 antibody
      • EPD 1 antibody
      • EPD1 antibody
      • Epiphyseal dysplasia 1 antibody
      • Epiphyseal dysplasia 1 multiple antibody
      • Epiphyseal dysplasia multiple 1 antibody
      • MED antibody
      • MGC13181 antibody
      • MGC149768 antibody
      • PSACH antibody
      • pseudoachondroplasia (epiphyseal dysplasia 1, multiple) antibody
      • Pseudoachondroplasia antibody
      • THBS 5 antibody
      • THBS5 antibody
      • Thrombospondin 5 antibody
      • Thrombospondin-5 antibody
      • Thrombospondin5 antibody
      • TSP5 antibody
      see all

    Images

    • Western blot - Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854)
      Western blot - Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854)
      All lanes : Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854) at 1 µg/ml

      Lane 1 : COMP/Cartilage oligomeric matrix protein-transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Secondary
      All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

      Developed using the ECL technique.

      Predicted band size: 80 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab171854? Please let us know so that we can cite the reference in this datasheet.

    ab171854 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab171854.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.