Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854)
Key features and details
- Mouse polyclonal to COMP/Cartilage oligomeric matrix protein
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-COMP/Cartilage oligomeric matrix protein antibody
See all COMP/Cartilage oligomeric matrix protein primary antibodies -
Description
Mouse polyclonal to COMP/Cartilage oligomeric matrix protein -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant full length protein corresponding to Human COMP/Cartilage oligomeric matrix protein aa 1-724. This sequence is a synthetic construct corresponding to aa 34-757 fragment of Human COMP/Cartilage oligomeric matrix protein according to Swissprot P49747.
Sequence:MLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLP SVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNA HPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINE CETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGS PSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCP ERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRN PDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQ ADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSD QDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDN CRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRA FQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFE GTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEP GIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYR WFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENII WANLRYRCNDTIPEDYETHQLRQA
Database link: ABM87644.1 -
Positive control
- COMP/Cartilage oligomeric matrix protein-transfected 293T cell lysate.
-
General notes
This product was previously labelled as COMP
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab171854 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa. |
Target
-
Function
May play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7. -
Tissue specificity
Abundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect. -
Involvement in disease
Defects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1) [MIM:132400]. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
Defects in COMP are the cause of pseudoachondroplasia (PSACH) [MIM:177170]. PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood. -
Sequence similarities
Belongs to the thrombospondin family.
Contains 4 EGF-like domains.
Contains 1 TSP C-terminal (TSPC) domain.
Contains 8 TSP type-3 repeats. -
Developmental stage
Present during the earliest stages of limb maturation and is later found in regions where the joints develop. -
Domain
The cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.
The TSP C-terminal domain mediates interaction with FN1 and ACAN. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
-
Database links
- Entrez Gene: 281088 Cow
- Entrez Gene: 1311 Human
- Entrez Gene: 12845 Mouse
- Entrez Gene: 25304 Rat
- Omim: 600310 Human
- SwissProt: P35445 Cow
- SwissProt: P49747 Human
- SwissProt: Q9R0G6 Mouse
see all -
Alternative names
- cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple) antibody
- Cartilage oligomeric matrix protein antibody
- Cartilage oligomeric matrix protein precursor antibody
see all
Images
-
All lanes : Anti-COMP/Cartilage oligomeric matrix protein antibody (ab171854) at 1 µg/ml
Lane 1 : COMP/Cartilage oligomeric matrix protein-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 80 kDa
Datasheets and documents
References (0)
ab171854 has not yet been referenced specifically in any publications.