Overview

  • Product name

    Anti-Complement factor 8 beta/C8B antibody
    See all Complement factor 8 beta/C8B primary antibodies
  • Description

    Rabbit polyclonal to Complement factor 8 beta/C8B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Complement factor 8 beta/C8B aa 55-350.
    Sequence:

    SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSD KEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEAN CRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHY ILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGF SFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHY KLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVL


    Database link: P07358

  • Positive control

    • IHC-P: Human liver and pancreatic cancer tissues.
  • General notes

     This product was previously labelled as Complement factor 8 beta

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells.
  • Involvement in disease

    Defects in C8B are a cause of complement component 8 deficiency type 2 (C8D2) [MIM:120960]. A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis.
  • Sequence similarities

    Belongs to the complement C6/C7/C8/C9 family.
    Contains 1 EGF-like domain.
    Contains 1 LDL-receptor class A domain.
    Contains 1 MACPF domain.
    Contains 2 TSP type-1 domains.
  • Post-translational
    modifications

    N-glycosylated; contains one or two bound glycans. Not O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C8b antibody
    • CO8B_HUMAN antibody
    • Complement component 8 beta polypeptide antibody
    • Complement component 8 subunit beta antibody
    • Complement component C8 beta chain antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for Complement factor 8 beta/C8B using ab230117 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for Complement factor 8 beta/C8B using ab230117 at 1/100 dilution in immunohistochemical analysis.

References

ab230117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up