Overview

  • Product name

    Anti-Connecdenn 3 antibody
  • Description

    Rabbit polyclonal to Connecdenn 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Connecdenn 3 aa 601-801.
    Sequence:

    PRWQPDDKKLPEPEPQPLSLPSLQNASSLDATSSSKDSRSQLIPSESDQE VTSPSQSSTASADPSIWGDPKPSPLTEPLILHLTPSHKAAEDSTAQENPT PWLSTAPTEPSPPESPQILAPTKPNFDIAWTSQPLDPSSDPSSLEDPRAR PPKALLAERAHLQPREEPGALNSPATPTSNCQKSQPSSRPRVADLKKCFE


    Database link: Q8IV53

  • Positive control

    • WB: Rat liver and lung lysates. IHC-P: Human lymph node and lung tissues.
  • General notes

    Previously labelled as DENND1C.

Properties

Applications

Our Abpromise guarantee covers the use of ab224721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 88 kDa (predicted molecular weight: 87 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Guanine nucleotide exchange factor (GEF) for RAB35.
  • Sequence similarities

    Contains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 uDENN domain.
  • Cellular localization

    Cytoplasm > cytosol. Cytoplasmic vesicle > clathrin-coated vesicle.
  • Information by UniProt
  • Database links

  • Alternative names

    • Connecdenn 3 antibody
    • DEN1C_HUMAN antibody
    • DENN domain containing 1C antibody
    • DENN domain-containing protein 1C antibody
    • Dennd1c antibody
    • FAM31C antibody
    • FLJ22757 antibody
    • Protein FAM31C antibody
    see all

Images

  • All lanes : Anti-Connecdenn 3 antibody (ab224721) at 1/500 dilution

    Lane 1 : Rat liver lysate
    Lane 2 : Rat lung lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 87 kDa
    Observed band size: 88 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human lymph node tissue stained for Connecdenn 3 using ab224721 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung tissue stained for Connecdenn 3 using ab224721 at 1/100 dilution in immunohistochemical analysis.

References

ab224721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up