Overview

  • Product name

  • Description

    Rabbit polyclonal to Contactin 6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human Contactin 6 aa 706-812.
    Sequence:

    NIHGGGGSRSELVITWESIPEELQNGEGFGYIIMFRPVGSTTWSKEKVSS VESSRFVYRNESIIPLSPFEVKVGVYNNEGEGSLSTVTIVYSGEDEPQLA PRGTSLQ


    Database link: Q9UQ52

  • Positive control

    • WB: A549 and HepG2 cell lysate. IHC: Human thyroid tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 114 kDa (predicted molecular weight: 114 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Contactins mediate cell surface interactions during nervous system development. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Involved in motor coordination.
  • Tissue specificity

    Expressed in nervous system. Highly expressed in cerebellum. Expressed at intermediate level in thalamus, subthalamic nucleus. Weakly expressed in corpus callosum, caudate nucleus and spinal cord.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. Contactin family.
    Contains 4 fibronectin type-III domains.
    Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CNTN 6 antibody
    • CNTN6 antibody
    • CNTN6_HUMAN antibody
    • Contactin 6 precursor antibody
    • Contactin-6 antibody
    • Contactin6 antibody
    • hNB 3 antibody
    • hNB-3 antibody
    • hNB3 antibody
    • MGC133256 antibody
    • NB 3 antibody
    • NB3 antibody
    • Neural adhesion molecule antibody
    • Neural recognition molecule NB 3 antibody
    • Neural recognition molecule NB-3 antibody
    see all

Images

  • All lanes : Anti-Contactin 6 antibody (ab224596) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 114 kDa
    Observed band size: 114 kDa

  • Paraffin-embedded human thyroid tissue stained for Contactin 6 using ab224596 at 1/100 dilution in immunohistochemical analysis.

References

ab224596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up