Overview

  • Product name

  • Description

    Rabbit polyclonal to COPB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human COPB2 aa 657-906.
    Sequence:

    AYQLAVEAESEQKWKQLAELAISKCQFGLAQECLHHAQDYGGLLLLATAS GNANMVNKLAEGAERDGKNNVAFMSYFLQGKVDACLELLIRTGRLPEAAF LARTYLPSQVSRVVKLWRENLSKVNQKAAESLADPTEYENLFPGLKEAFV VEEWVKETHADLWPAKQYPLVTPNEERNVMEEGKDFQPSRSTAQQELDGK PASPTPVIVASHTANKEEKSLLELEVDLDNLELEDIDTTDINLDEDILDD


    Database link: P35606

  • Positive control

    • WB: Human placenta tisue lysate; MCF7, HeLa, HepG2 and Jurkat whole cell lysates. IHC-P: Human spleen and placenta tissue.
  • General notes

     This product was previously labelled as beta COP I

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 102 kDa (predicted molecular weight: 102, 99 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
    This coatomer complex protein, essential for Golgi budding and vesicular trafficking, is a selective binding protein (RACK) for protein kinase C, epsilon type. It binds to Golgi membranes in a GTP-dependent manner.
  • Sequence similarities

    Belongs to the WD repeat COPB2 family.
    Contains 9 WD repeats.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta'-coat protein antibody
    • Beta'-COP antibody
    • Coatomer subunit beta' antibody
    • Copb2 antibody
    • COPB2_HUMAN antibody
    • p102 antibody
    see all

Images

  • All lanes : Anti-COPB2 antibody (ab229639) at 1/1000 dilution

    Lane 1 : Human placenta tissue lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat anti-Rabbit at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 102, 99 kDa
    Observed band size: 102 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human spleen tissue stained for COPB2 with ab229639 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for COPB2 with ab229639 at 1/100 dilution in immunohistochemical analysis.

References

ab229639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up