Overview

  • Product name

  • Description

    Rabbit polyclonal to COPE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Chinese hamster, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human COPE aa 12-91.
    Sequence:

    GSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPERDVERDVFLYRAYL AQRKFGVVLDEIKPSSAPELQAVRMFADYL


    Database link: O14579

  • Positive control

    • IHC-P: Human pancreas lysate. WB: RT4 and U-251 MG cell lysate; Human plasma, liver and tonsil tissue lysate. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB Use a concentration of 0.4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
  • Sequence similarities

    Belongs to the COPE family.
  • Post-translational
    modifications

    Phosphorylated by PKA.
    Polyubiquitinated by RCHY1 in the presence of androgen, leading to proteasomal degradation.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1110005D17Rik antibody
    • Coatomer epsilon subunit antibody
    • Coatomer protein complex subunit epsilon antibody
    • Coatomer subunit epsilon antibody
    • COPE antibody
    • COPE_HUMAN antibody
    • Cope1 antibody
    • Epsilon coat protein antibody
    • Epsilon COP antibody
    • Epsilon COP I antibody
    • Epsilon subunit of coatomer protein complex antibody
    • Epsilon-coat protein antibody
    • Epsilon-COP antibody
    • FLJ13241 antibody
    see all

Images

  • All lanes : Anti-COPE antibody (ab244467) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate
  • Paraffin-embedded human pancreas tissue stained for COPE using ab244467 at 1/50 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for COPE (green) using ab244467 at 4 μg/ml in ICC/IF.

References

ab244467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up