Overview

  • Product name

  • Description

    Rabbit polyclonal to COPZ1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human COPZ1 aa 1-177.
    Sequence:

    MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFN KTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDS LSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRG EDVPLTEQTVSQVLQSAKEQIKWSLLR


    Database link: P61923

  • Positive control

    • WB: Hela, NIH/3T3, RAW 264.7, Jurkat and K562 whole cell lysate. IHC-P: Human brain and cervical cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 20 kDa.

Target

  • Relevance

    The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
  • Cellular localization

    Cytoplasm. Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle; COPI-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side.
  • Database links

  • Alternative names

    • CGI-120 antibody
    • Coatomer protein complex, subunit zeta 1 antibody
    • Coatomer subunit zeta-1 antibody
    • COPZ antibody
    • HSPC181 antibody
    • Zeta-1 COP antibody
    • Zeta-1-coat protein antibody
    • Zeta-COP antibody
    • Zeta1-COP antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for COPZ1 using ab236670 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-COPZ1 antibody (ab236670) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 3 : RAW 264.7 (mouse macrophage cell line transformed with Abelson murine leukemia virus) whole cell lysate
    Lane 4 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 5 : Mouse liver tissue lysate
    Lane 6 : Mouse kidney tissue lysate
    Lane 7 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 20 kDa

  • Paraffin-embedded human cervical cancer tissue stained for COPZ1 using ab236670 at 1/100 dilution in immunohistochemical analysis.

References

ab236670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up