Overview

  • Product name

  • Description

    Rabbit polyclonal to COQ2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human COQ2 aa 296-334.
    Sequence:

    NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI


    Database link: Q96H96

  • Positive control

    • RT-4 cell lysate; A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

WB 1/100 - 1/250. Predicted molecular weight: 40 kDa.

Target

  • Function

    Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.
  • Tissue specificity

    Widely expressed. Present in all of the tissues tested. Expressed at higher level in skeletal muscle, adrenal glands and the heart.
  • Pathway

    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Involvement in disease

    Defects in COQ2 are the cause of coenzyme Q10 deficiency, primary, type 1 (COQ10D1) [MIM:607426]. An autosomal recessive disorder with variable manifestations consistent with 5 major phenotypes. The phenotypes include an encephalomyopathic form with seizures and ataxia; a multisystem infantile form with encephalopathy, cardiomyopathy and renal failure; a predominantly cerebellar form with ataxia and cerebellar atrophy; Leigh syndrome with growth retardation; and an isolated myopathic form.
  • Sequence similarities

    Belongs to the UbiA prenyltransferase family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310002F18Rik antibody
    • 4-hydroxybenzoate polyprenyltransferase antibody
    • CL640 antibody
    • Coenzyme Q2 4-hydroxybenzoate polyprenyltransferase antibody
    • Coenzyme Q2 homolog, prenyltransferase (yeast) antibody
    • COQ10D1 antibody
    • COQ2 antibody
    • COQ2 homolog antibody
    • COQ2_HUMAN antibody
    • FLJ13014 antibody
    • FLJ26072 antibody
    • hCOQ2 antibody
    • MGC124824 antibody
    • MGC91278 antibody
    • mitochondrial antibody
    • MSA1 antibody
    • OTTMUSP00000032111 antibody
    • Para-hydroxybenzoate--polyprenyltransferase antibody
    • Para-hydroxybenzoate--polyprenyltransferase, mitochondrial antibody
    • PHB:polyprenyltransferase antibody
    • RGD1306722 antibody
    see all

Images

  • Anti-COQ2 antibody (ab220914) at 1/100 dilution + RT-4 cell lysate

    Predicted band size: 40 kDa

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized A431 cells labeling COQ2 with ab220914 at 4 μg/ml (green).

References

ab220914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up