For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    coq6-antibody-ab233168.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Sensory System Auditory system
Share by email

Anti-COQ6 antibody (ab233168)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
  • Western blot - Anti-COQ6 antibody (ab233168)
  • Western blot - Anti-COQ6 antibody (ab233168)

Key features and details

  • Rabbit polyclonal to COQ6
  • Suitable for: IHC-P, WB
  • Reacts with: Human, Pig
  • Isotype: IgG

You may also be interested in

Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-COQ6 antibody
    See all COQ6 primary antibodies
  • Description

    Rabbit polyclonal to COQ6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human COQ6 aa 1-468.
    Sequence:

    MAARLVSRCGAVRAAPHSGPLVSWRRWSGASTDTVYDVVVSGGGLVGAAM ACALGYDIHFHDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSS FGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMH ALTKQLEAVSDRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGDGSTFQ TKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSEATENNVAWQR FLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSD ADHTDFIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGL GHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNG KDLGSVSHLTGYETERQRHNTALLAATDLLKRLYSTSASPLVLLRTWGLQ ATNAVSPLKEQIMAFASK


    Database link: Q9Y2Z9
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: Recombinant human COQ6; Pig kidney and heart tissue lysate. IHC-P: Human liver, skin cancer, kidney, prostate, breast cancer and cerebrum tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Sensory System
    • Auditory system
    • Metabolism
    • Pathways and Processes
    • Cofactors, Vitamins / minerals
    • Co-factors

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab233168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 51 kDa.

Target

  • Pathway

    Cofactor biosynthesis; ubiquinone biosynthesis.
  • Sequence similarities

    Belongs to the ubiH/COQ6 family.
  • Target information above from: UniProt accession Q9Y2Z9 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 51004 Human
    • Entrez Gene: 100155731 Pig
    • SwissProt: Q9Y2Z9 Human
    • Unigene: 131555 Human
    • Alternative names

      • CGI-10 antibody
      • Coenzyme Q6 homolog (yeast) antibody
      • Coenzyme Q6 homolog, monooxygenase (S. cerevisiae) antibody
      • Coenzyme Q6 homolog, monooxygenase (yeast) antibody
      • coq6 antibody
      • COQ6_HUMAN antibody
      • Ubiquinone biosynthesis monooxygenase COQ6 antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)

      Formalin-fixed, paraffin-embedded human liver tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)

      Formalin-fixed, paraffin-embedded human skin cancer tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)

      Formalin-fixed, paraffin-embedded human kidney tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)

      Formalin-fixed, paraffin-embedded human prostate tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)

      Formalin-fixed, paraffin-embedded human breast cancer tissue stained for COQ6 using ab233168 at 20μg/ml in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)

      Formalin-fixed, paraffin-embedded human cerebrum tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.

    • Western blot - Anti-COQ6 antibody (ab233168)
      Western blot - Anti-COQ6 antibody (ab233168)
      Anti-COQ6 antibody (ab233168) at 1 µg/ml + Recombinant human COQ6

      Secondary
      HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

      Predicted band size: 51 kDa

    • Western blot - Anti-COQ6 antibody (ab233168)
      Western blot - Anti-COQ6 antibody (ab233168)
      All lanes : Anti-COQ6 antibody (ab233168) at 1 µg/ml

      Lane 1 : Pig lung tissue lysate
      Lane 2 : Pig heart tissue lysate

      Secondary
      All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

      Predicted band size: 51 kDa

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab233168? Please let us know so that we can cite the reference in this datasheet.

    ab233168 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab233168.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.