Anti-COQ6 antibody (ab233168)
Key features and details
- Rabbit polyclonal to COQ6
- Suitable for: IHC-P, WB
- Reacts with: Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-COQ6 antibody
See all COQ6 primary antibodies -
Description
Rabbit polyclonal to COQ6 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Pig -
Immunogen
Recombinant full length protein corresponding to Human COQ6 aa 1-468.
Sequence:MAARLVSRCGAVRAAPHSGPLVSWRRWSGASTDTVYDVVVSGGGLVGAAM ACALGYDIHFHDKKILLLEAGPKKVLEKLSETYSNRVSSISPGSATLLSS FGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMH ALTKQLEAVSDRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGDGSTFQ TKLLIGADGHNSGVRQAVGIQNVSWNYDQSAVVATLHLSEATENNVAWQR FLPSGPIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSD ADHTDFIDTAGAMLQYAVSLLKPTKVSARQLPPSVARVDAKSRVLFPLGL GHAAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSTAAFNG KDLGSVSHLTGYETERQRHNTALLAATDLLKRLYSTSASPLVLLRTWGLQ ATNAVSPLKEQIMAFASK
Database link: Q9Y2Z9 -
Positive control
- WB: Recombinant human COQ6; Pig kidney and heart tissue lysate. IHC-P: Human liver, skin cancer, kidney, prostate, breast cancer and cerebrum tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab233168 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 51 kDa. |
Target
-
Pathway
Cofactor biosynthesis; ubiquinone biosynthesis. -
Sequence similarities
Belongs to the ubiH/COQ6 family. - Information by UniProt
-
Database links
- Entrez Gene: 51004 Human
- Entrez Gene: 100155731 Pig
- SwissProt: Q9Y2Z9 Human
- Unigene: 131555 Human
-
Alternative names
- CGI-10 antibody
- Coenzyme Q6 homolog (yeast) antibody
- Coenzyme Q6 homolog, monooxygenase (S. cerevisiae) antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
Formalin-fixed, paraffin-embedded human liver tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
Formalin-fixed, paraffin-embedded human skin cancer tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
Formalin-fixed, paraffin-embedded human kidney tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
Formalin-fixed, paraffin-embedded human prostate tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
Formalin-fixed, paraffin-embedded human breast cancer tissue stained for COQ6 using ab233168 at 20μg/ml in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-COQ6 antibody (ab233168)
Formalin-fixed, paraffin-embedded human cerebrum tissue stained for COQ6 using ab233168 at 20 μg/ml in immunohistochemical analysis.
-
Anti-COQ6 antibody (ab233168) at 1 µg/ml + Recombinant human COQ6
Secondary
HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 51 kDa -
All lanes : Anti-COQ6 antibody (ab233168) at 1 µg/ml
Lane 1 : Pig lung tissue lysate
Lane 2 : Pig heart tissue lysate
Secondary
All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
Predicted band size: 51 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233168 has not yet been referenced specifically in any publications.