Overview

  • Product name

  • Description

    Rabbit polyclonal to Corin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human Corin aa 207-248 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    HGLLPCRSFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTE


    Database link: Q9Y5Q5

  • Positive control

    • Rat cardiac muscle tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab209963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Serine-type endopeptidase involved in atrial natriuretic peptide hormone processing. Converts through proteolytic cleavage the non-functional propeptide NPPA/ANP into the active hormone which promotes natriuresis, diuresis, and vasodilatation. May also process pro-NPPB the B-type natriuretic peptide.
  • Tissue specificity

    Highly expressed in heart. Expressed in heart myocytes.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 FZ (frizzled) domains.
    Contains 7 LDL-receptor class A domains.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Post-translational
    modifications

    N-glycosylated; required for processing and activation.
    Activated through proteolytic processing by a trypsin-like protease; cleaved into a N-terminal propeptide and an activated corin protease fragment.
    A disulfide bond links the N-terminal propeptide and the activated corin protease fragment.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • activated protease fragment antibody
    • ATC 2 antibody
    • ATC2 antibody
    • Atrial natriuretic peptide-converting enzyme antibody
    • Atrial natriuteric peptide converting enzyme antibody
    • Corin antibody
    • Corin serine peptidase antibody
    • CORIN_HUMAN antibody
    • CRN antibody
    • Heart specific serine proteinase antibody
    • Heart specific serine proteinase ATC2 antibody
    • Heart-specific serine proteinase ATC2 antibody
    • MGC119742 antibody
    • Pro ANP convertase antibody
    • Pro ANP converting enzyme antibody
    • Pro-ANP-converting enzyme antibody
    • TMPRSS 10 antibody
    • TMPRSS10 antibody
    • Transmembrane protease serine 10 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat cardiac muscle tissue labeling Corin with ab209963 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab209963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up