Overview

  • Product name

  • Description

    Rabbit polyclonal to Corin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Corin aa 533-634. N-terminal tag. Expressed in E. coli.
    Sequence:

    PYNLTHYPNYLGHRTQKEASISWESALFPALVQTNCYKYLMFFACTILVP KCDVNTGQRVPPCRLLCEHSKERCESVLGIVGLQWPEDTDCSQFPEQSSD NQ


    Database link: Q80YN4

  • Positive control

    • WB: Recombinant rat Corin protein and rat heart tissue lysate. IHC-P: Rat heart tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 123 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Serine-type endopeptidase involved in atrial natriuretic peptide hormone processing. Converts through proteolytic cleavage the non-functional propeptide NPPA/ANP into the active hormone which promotes natriuresis, diuresis, and vasodilatation. May also process pro-NPPB the B-type natriuretic peptide.
  • Tissue specificity

    Highly expressed in heart. Expressed in heart myocytes.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 FZ (frizzled) domains.
    Contains 7 LDL-receptor class A domains.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Post-translational
    modifications

    N-glycosylated; required for processing and activation.
    Activated through proteolytic processing by a trypsin-like protease; cleaved into a N-terminal propeptide and an activated corin protease fragment.
    A disulfide bond links the N-terminal propeptide and the activated corin protease fragment.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • activated protease fragment antibody
    • ATC 2 antibody
    • ATC2 antibody
    • Atrial natriuretic peptide-converting enzyme antibody
    • Atrial natriuteric peptide converting enzyme antibody
    • Corin antibody
    • Corin serine peptidase antibody
    • CORIN_HUMAN antibody
    • CRN antibody
    • Heart specific serine proteinase antibody
    • Heart specific serine proteinase ATC2 antibody
    • Heart-specific serine proteinase ATC2 antibody
    • MGC119742 antibody
    • Pro ANP convertase antibody
    • Pro ANP converting enzyme antibody
    • Pro-ANP-converting enzyme antibody
    • TMPRSS 10 antibody
    • TMPRSS10 antibody
    • Transmembrane protease serine 10 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat heart tissue stained for Corin using ab232807 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Corin antibody (ab232807) at 2 µg/ml + Rat heart tissue lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml

    Predicted band size: 123 kDa

  • Anti-Corin antibody (ab232807) at 2 µg/ml + Recombinant rat Corin protein

    Predicted band size: 123 kDa

References

ab232807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up