Anti-Corneodesmosin/S protein antibody (ab204235)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Corneodesmosin/S protein antibody
See all Corneodesmosin/S protein primary antibodies -
Description
Rabbit polyclonal to Corneodesmosin/S protein -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Pig, Rhesus monkey -
Immunogen
Recombinant fragment corresponding to Human Corneodesmosin/S protein aa 433-505.
Sequence:SSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAG AKPCGSSSAGKIPCRSIRDILAQ
Database link: Q15517 -
Positive control
- Human skin tissue.
-
General notes
Protein previously labeled as Corneodesmosin.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab204235 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Important for the epidermal barrier integrity. -
Tissue specificity
Exclusively expressed in skin. -
Involvement in disease
Defects in CDSN are a cause of hypotrichosis simplex of the scalp (HTSS) [MIM:146520]; also known as hypotrichosis Spanish type. HTSS is an autosomal dominant form of isolated alopecia. Affected individuals have normal hair in early childhood but experience progressive loss of scalp hair beginning in the middle of the first decade and almost complete baldness by the third decade.
Defects in CDSN are the cause of peeling skin syndrome type B (BPSS) [MIM:270300]; also known as peeling skin syndrome or deciduous skin or keratolysis exfoliativa congenita. BPSS is a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis, associated with pruritus and atopy. It is an ichthyosiform erythroderma characterized by lifelong patchy peeling of the entire skin with onset at birth or shortly thereafter. Several patients have been reported with high IgE levels. -
Cellular localization
Secreted. Found in corneodesmosomes, the intercellular structures that are involved in desquamation. - Information by UniProt
-
Database links
- Entrez Gene: 1041 Human
- Entrez Gene: 100144482 Pig
- Entrez Gene: 714553 Rhesus monkey
- Omim: 602593 Human
- SwissProt: Q15517 Human
- SwissProt: O19084 Pig
- SwissProt: Q5TM45 Rhesus monkey
- Unigene: 556031 Human
-
Alternative names
- AI747712 antibody
- CDSN antibody
- CDSN_HUMAN antibody
see all
Images
Protocols
References
ab204235 has not yet been referenced specifically in any publications.