Anti-Corneodesmosin/S protein antibody (ab204235)
Key features and details
- Rabbit polyclonal to Corneodesmosin/S protein
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Corneodesmosin/S protein antibody
See all Corneodesmosin/S protein primary antibodies -
Description
Rabbit polyclonal to Corneodesmosin/S protein -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Pig, Rhesus monkey
-
Immunogen
Recombinant fragment corresponding to Human Corneodesmosin/S protein aa 433-505.
Sequence:SSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAG AKPCGSSSAGKIPCRSIRDILAQ
Database link: Q15517 -
Positive control
- IHC-P: Human skin tissue.
-
General notes
Protein previously labeled as Corneodesmosin.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab204235 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Important for the epidermal barrier integrity. -
Tissue specificity
Exclusively expressed in skin. -
Involvement in disease
Defects in CDSN are a cause of hypotrichosis simplex of the scalp (HTSS) [MIM:146520]; also known as hypotrichosis Spanish type. HTSS is an autosomal dominant form of isolated alopecia. Affected individuals have normal hair in early childhood but experience progressive loss of scalp hair beginning in the middle of the first decade and almost complete baldness by the third decade.
Defects in CDSN are the cause of peeling skin syndrome type B (BPSS) [MIM:270300]; also known as peeling skin syndrome or deciduous skin or keratolysis exfoliativa congenita. BPSS is a genodermatosis characterized by the continuous shedding of the outer layers of the epidermis, associated with pruritus and atopy. It is an ichthyosiform erythroderma characterized by lifelong patchy peeling of the entire skin with onset at birth or shortly thereafter. Several patients have been reported with high IgE levels. -
Cellular localization
Secreted. Found in corneodesmosomes, the intercellular structures that are involved in desquamation. - Information by UniProt
-
Database links
- Entrez Gene: 1041 Human
- Entrez Gene: 100144482 Pig
- Entrez Gene: 714553 Rhesus monkey
- Omim: 602593 Human
- SwissProt: Q15517 Human
- SwissProt: O19084 Pig
- SwissProt: Q5TM45 Rhesus monkey
- Unigene: 556031 Human
-
Alternative names
- AI747712 antibody
- CDSN antibody
- CDSN_HUMAN antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Corneodesmosin/S protein antibody (ab204235)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of skin tissue labelling Corneodesmosin/S protein with ab204235 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Corneodesmosin/S protein antibody (ab204235)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of kidney tissue labelling Corneodesmosin/S protein with ab204235 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Corneodesmosin/S protein antibody (ab204235)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of liver tissue labelling Corneodesmosin/S protein with ab204235 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Corneodesmosin/S protein antibody (ab204235)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of pancreas tissue labelling Corneodesmosin/S protein with ab204235 at 1/200 dilution. Heat mediated antigen retrieval performed with citrate buffer pH 6 before commencing with IHC staining protocol.
References (0)
ab204235 has not yet been referenced specifically in any publications.
