Overview

  • Product name

  • Description

    Rabbit polyclonal to Cornulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cornulin aa 167-266.
    Sequence:

    YDRQAESQSQERISPQIQLSGQTEQTQKAGEGKRNQTTEMRPERQPQTRE QDRAHQTGETVTGSGTQTQAGATQTVEQDSSHQTGRTSKQTQEATNDQNR


    Database link: Q9UBG3

  • Positive control

    • IHC-P: Human oral mucosa tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Survival factor that participates in the clonogenicity of squamous esophageal epithelium cell lines, attenuates deoxycholic acid (DCA)-induced apoptotic cell death and release of calcium. When overexpressed in oral squamous carcinom cell lines, regulates negatively cell proliferation by the induction of G1 arrest.
  • Tissue specificity

    Squamous epithelia cell-specific. Expressed in the esophagus (periphery of the cells of the granular and the upper spinous layers), foreskin (granular and lower cornified cells), scalp skin (granular layer), inner root sheath of the hair follicle and in primary keratinocytes (at protein level). Expressed in the squamous epithelium of the cervix, esophagus, foreskin and larynx. Expressed in the fetal bladder and scalp skin. Expressed at very low levels in the lung, kidney, uterus, skeletal muscle, heart and fetal brain. Undetectable or barely detectable in esophageal and oral squamous cell carcinoma compared with the matched adjacent normal esophageal mucosa. Undetectable or barely detectable in larynx and esophagus from patients with pH-documented laryngopharyngeal reflux (LPR).
  • Sequence similarities

    Belongs to the S100-fused protein family.
    Contains 1 EF-hand domain.
  • Domain

    The EF-hand is necessary for the colony survival activity to protect cells from death induced by exposure to DCA.
  • Cellular localization

    Cytoplasm. Does not colocalize with TGM1.
  • Information by UniProt
  • Database links

  • Alternative names

    • 53 kDa putative calcium binding protein antibody
    • 53 kDa putative calcium-binding protein antibody
    • 53 kDa squamous epithelial induced stress protein antibody
    • 53 kDa squamous epithelial-induced stress protein antibody
    • 58 kDa heat shock protein antibody
    • C1orf10 antibody
    • Chromosome 1 open reading frame 10 antibody
    • Cornulin antibody
    • CRNN antibody
    • CRNN_HUMAN antibody
    • DRC1 antibody
    • PDRC1 antibody
    • SEP53 antibody
    • Squamous epithelial heat shock protein 53 antibody
    • Tumor related protein antibody
    • Tumor-related protein antibody
    see all

Images

  • Paraffin-embedded human oral mucosa tissue stained for Cornulin with ab224122 (1/50) in immunohistochemical analysis.

References

ab224122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up