Overview

  • Product name

  • Description

    Rabbit polyclonal to Cortactin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Rat Cortactin aa 1-509.
    Sequence:

    MWKASAGHAVSITQDDGGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQ EHINIHKLRENVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAV GHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHAS QKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYG IDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGW DHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKT VPIEAVTSKTSNIRANFENLAKEREQEDRRKAEAERAQRMAQERQEQEEA RRKLEEQARAKKQTPPASPSPQPAEDRPPSSPIYEDAAPLKAEPSYGSSE PEPEYSTEAAGLPEASNQQGLAYTSEPVYETTEVPGHYQAEDDTYDGYES DLGITAIALYDYQAAGDDEISFDPDDVITNIEMIDDGWWRGVCKGRYGLF PANYVELRQ


    Database link: Q66HL2

  • Positive control

    • WB: Recombinant rat Cortactin; Rat lung tissue. IHC-P: Rat kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.05% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 57 kDa.

Target

  • Function

    Contributes to the organization of the actin cytoskeleton and cell structure. Plays a role in the regulation of cell migration. Plays a role in the invasiveness of cancer cells, and the formation of metastases.
  • Sequence similarities

    Contains 7 cortactin repeats.
    Contains 1 SH3 domain.
  • Domain

    The SH3 motif may mediate binding to the cytoskeleton.
  • Post-translational
    modifications

    Tyrosine phosphorylation in transformed cells may contribute to cellular growth regulation and transformation.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection > lamellipodium. Cell projection > ruffle. Associated with membrane ruffles and lamellipodia.
  • Information by UniProt
  • Database links

  • Alternative names

    • Amplaxin antibody
    • CTTN antibody
    • EMS 1 antibody
    • EMS1 antibody
    • FLJ34459 antibody
    • Mammary tumor and squamous cell carcinoma associated antibody
    • Oncogene EMS1 antibody
    • p80/85 src substrate antibody
    • Src substrate cortactin antibody
    • SRC8_HUMAN antibody
    see all

Images

  • Anti-Cortactin antibody (ab230992) at 2 µg/ml + Recombinant rat Cortactin

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • All lanes : Anti-Cortactin antibody (ab230992) at 2 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat lung lysate
    Lane 3 : Rat placenta lysate
    Lane 4 : Rat uterus lysate
    Lane 5 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 57 kDa

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for Cortactin with ab230992 at 20 μg/ml in immunohistochemical analysis.

References

ab230992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up