Overview

  • Product name

  • Description

    Rabbit polyclonal to COSMC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human COSMC aa 30-190.
    Sequence:

    IGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKD VSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYA FDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLE YVGMEGGIVLS


    Database link: Q96EU7

  • Positive control

    • WB: Mouse gonadal and liver lysates. IHC-P: Human kidney and gastric cancer tissues. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as C1GALT1C1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab229831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa).
ICC/IF 1/50 - 1/200.

Target

  • Function

    Probable chaperone required for the generation of 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Probably acts as a specific molecular chaperone assisting the folding/stability of core 1 beta-3-galactosyltransferase (C1GALT1).
  • Tissue specificity

    Ubiquitously expressed. Abundantly expressed in salivary gland, stomach, small intestine, kidney, and testis and at intermediate levels in whole brain, cerebellum, spinal cord, thymus, spleen, trachea, lung, pancreas, ovary, and uterus.
  • Involvement in disease

    Defects in C1GALT1C1 are the cause of Tn syndrome (TNSYN) [MIM:300622]. Tn syndrome is a rare autoimmune disease caused by somatic mutation in the C1GALT1C1 gene in which subpopulations of blood cells of all lineages carry an incompletely glycosylated membrane glycoprotein, i.e. the Tn antigen. Since leukocytes and platelets are affected as well as red cells, anemia, leukopenia and thrombocytopenia are features. Tn-polyagglutinability is sometimes associated with leukemia or is a preleukemic state.
  • Sequence similarities

    Belongs to the glycosyltransferase 31 family. Beta3-Gal-T subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSPC067 antibody
    • 3-galactosyltransferase 2 antibody
    • Beta 1,3 galactosyltransferase 2 antibody
    • Beta1,3 galactosyltransferase 2 antibody
    • C1Gal T2 antibody
    • C1Gal-T2 antibody
    • C1GALT1 specific chaperone 1 antibody
    • C1GALT1-specific chaperone 1 antibody
    • C1galt1c1 antibody
    • C1GalT2 antibody
    • C1GLC_HUMAN antibody
    • C38H2 L1 antibody
    • C38H2 like protein 1 antibody
    • C38H2-L1 antibody
    • C38H2-like protein 1 antibody
    • C38H2L1 antibody
    • Core 1 beta1 antibody
    • Core 1 beta3 galactosyltransferase specific molecular chaperone antibody
    • Core 1 beta3-Gal-T2 antibody
    • Core 1 beta3-galactosyltransferase-specific molecular chaperone antibody
    • Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1,3 galactosyltransferase 2 antibody
    • COSMC antibody
    • MGC19947 antibody
    • MST143 antibody
    see all

Images

  • All lanes : Anti-COSMC antibody (ab229831) at 1/500 dilution

    Lane 1 : Mouse gonadal lysate
    Lane 2 : Mouse liver lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa

  • Paraffin-embedded human kidney tissue stained for COSMC using ab229831 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for COSMC using ab229831 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for COSMC (green) using ab229831 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab229831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up