Overview

  • Product name

  • Description

    Sheep polyclonal to COTL1
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human COTL1 aa 2-142. (Derived from E.coli).
    Sequence:

    ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQ CTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLV KEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE


    Database link: Q14019

  • Positive control

    • Human placenta tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab215064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 15 kDa (predicted molecular weight: 16 kDa).

Target

Images

References

ab215064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up