Overview

  • Product name

  • Description

    Sheep polyclonal to COTL1
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human COTL1 aa 2-142. Derived from E. coli.
    Sequence:

    ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQ CTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLV KEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE


    Database link: Q14019

  • Positive control

    • Mouse embryonic tissue lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab216135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 16 kDa.

Target

Images

  • Anti-COTL1 antibody (ab216135) at 1/1000 dilution + Mouse embryonic tissue lysates

    Predicted band size: 16 kDa

References

ab216135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up