Overview

  • Product name

  • Description

    Rabbit polyclonal to COTL1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human COTL1 aa 2-142.
    Sequence:

    ATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQ CTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLV KEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE


    Database link: Q14019

  • Positive control

    • WB: Mouse brain, kidney and thymus lysate; HeLa, HepG2, U-87 MG, HL-60 and A549 whole cell lysate. IHC-P: Human lung cancer and lymphoid tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235833 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000.

Target

Images

  • All lanes : Anti-COTL1 antibody (ab235833) at 1/1000 dilution

    Lane 1 : Mouse brain tissue lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 5 : Mouse thymus tissue lysate
    Lane 6 : U-87 MG (human glioblastoma-astrocytoma epithelial cell line) whole cell lysate
    Lane 7 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 8 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution
  • Paraffin-embedded human lymphoid tissue stained for COTL1 using ab235833 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung cancer tissue stained for COTL1 using ab235833 at 1/100 dilution in immunohistochemical analysis.

References

ab235833 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235833.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up