Overview

  • Product name

  • Description

    Rabbit polyclonal to COX IV
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Zebrafish
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant full length protein corresponding to Human COX IV aa 23-169.
    Sequence:

    AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSS LSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQK HYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK


    Database link: P13073

  • Positive control

    • WB: Rat brain and muscle tissue lysates; Zebrafish lysate. IHC-P: Human colon cancer and gastric cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236100 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 19 kDa.

Target

  • Function

    This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the cytochrome c oxidase IV family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AL024441 antibody
    • COX 4 antibody
    • COX IV 1 antibody
    • COX IV antibody
    • COX IV-1 antibody
    • Cox4 antibody
    • COX41_HUMAN antibody
    • Cox4a antibody
    • COX4B antibody
    • COX4I1 antibody
    • COX4I2 antibody
    • COX4L2 antibody
    • COXIV antibody
    • Cytochrome c oxidase polypeptide IV antibody
    • Cytochrome c oxidase subunit 4 isoform 1 mitochondrial antibody
    • Cytochrome c oxidase subunit 4 isoform 1, mitochondrial antibody
    • Cytochrome C Oxidase subunit IV antibody
    • Cytochrome c oxidase subunit IV isoform 1 antibody
    • Cytochrome c oxidase subunit IV isoform 2 (lung) antibody
    • Cytochrome c oxydase subunit 4 antibody
    • dJ857M17.2 antibody
    • MGC105470 antibody
    • MGC72016 antibody
    see all

Images

  • All lanes : Anti-COX IV antibody (ab236100) at 1/1000 dilution

    Lane 1 : Rat muscle tissue lysate
    Lane 2 : Zebrafish lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 19 kDa

  • Paraffin-embedded human gastric cancer tissue stained for COX IV with ab236100 at 1/100 dilution in immunohistochemical analysis.

  • Anti-COX IV antibody (ab236100) at 1/1000 dilution + Rat brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 19 kDa

  • Paraffin-embedded human colon cancer tissue stained for COX IV with ab236100 at 1/100 dilution in immunohistochemical analysis.

References

ab236100 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236100.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up