Overview

  • Product name

    Anti-COX11 antibody
  • Description

    Rabbit polyclonal to COX11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human COX11 aa 115-276. Mitochondrial intermembrane domain.
    Sequence:

    PLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQW NFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNK IQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEA KEGHKLPVPGYN


    Database link: Q9Y6N1-1

  • Positive control

    • IHC-P: Human colon cancer and kidney tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the COX11/CtaG family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • COX11 antibody
    • COX11 homolog antibody
    • COX11 homolog, cytochrome c oxidase assembly protein (yeast) antibody
    • COX11_HUMAN antibody
    • COX11P antibody
    • Cytochrome c oxidase assembly protein COX11 antibody
    • Cytochrome c oxidase assembly protein COX11, mitochondrial antibody
    • Cytochrome c oxidase subunit 11 antibody
    • mitochondrial antibody
    see all

Images

  • MCF7 (Human breast adenocarcinoma cell line) cells stained for COX11 (green) using ab238902 at 1/100 dilution in ICC/IF. Secondary antibody is an Alexa-Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for COX11 using ab238902 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for COX11 using ab238902 at 1/100 dilution in immunohistochemical analysis.

References

ab238902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up