Overview

  • Product name

  • Description

    Rabbit polyclonal to COX20
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human COX20 aa 71-118 (internal sequence).
    Sequence:

    LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN


    Database link: NP_932342

  • Positive control

    • Human fetal muscle lysate.
  • General notes

    Previously labelled as FAM36A. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 13 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay 1/62500.

IHC-P Use at an assay dependent concentration.

Target

  • Relevance

    COX20 is a multi-pass membrane protein. It belongs to the COX20 family. The exact function of COX20 remains unknown.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • COX20 antibody
    • COX20 cytochrome c oxidase assembly factor antibody
    • Cytochrome c oxidase protein 20 homolog antibody
    • FAM 36A antibody
    • FAM36A antibody
    • Family with sequence similarity 36 member A antibody
    • FLJ43269 antibody
    • Hypothetical protein LOC116228 antibody
    • OTTHUMP00000038200 antibody
    • Protein FAM36A antibody
    see all

Images

  • Anti-COX20 antibody (ab81308) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 13 kDa
    Observed band size: 13 kDa
    Additional bands at: 23 kDa. We are unsure as to the identity of these extra bands.



    Gel Concentration 10-20%

References

ab81308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (CNS)
Specification
CNS
Fixative
Formaldehyde
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: TE-buffer
Permeabilization
No

Abcam user community

Verified customer

Submitted Jul 20 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up