Anti-COX7A2L antibody (ab222129)
Key features and details
- Rabbit polyclonal to COX7A2L
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-COX7A2L antibody
See all COX7A2L primary antibodies -
Description
Rabbit polyclonal to COX7A2L -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human COX7A2L aa 3-76.
Sequence:YKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVY DYAGKNKVPELQKFFQKADGVPVY
Database link: O14548 -
Positive control
- ICC/IF: U-2 OS cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab222129 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
May be a regulatory subunit of cytochrome c oxidase that mediates the higher level of energy production in target cells by estrogen. -
Sequence similarities
Belongs to the cytochrome c oxidase VIIa family. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 9167 Human
- Omim: 605771 Human
- SwissProt: O14548 Human
- Unigene: 339639 Human
- Unigene: 741313 Human
-
Alternative names
- COX7a related protein antibody
- COX7a-related protein antibody
- COX7A2L antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-COX7A2L antibody (ab222129)PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for COX7A2L (green) using ab222129 at 4 µg/ml in ICC/IF.
Protocols
Datasheets and documents
References (0)
ab222129 has not yet been referenced specifically in any publications.
