Overview

  • Product name

  • Description

    Rabbit polyclonal to CPE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Pig, Chimpanzee, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human CPE aa 36-85 (N terminal).
    Sequence:

    GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG


    Database link: NP_001864

  • Positive control

    • MCF7 cell lysate.
  • General notes

     This product was previously labelled as Carboxypeptidase H

     

Properties

Applications

Our Abpromise guarantee covers the use of ab84631 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 53 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin.
  • Tissue specificity

    Isoform 2, but not isoform 1, is overexpressed in hepatocellular carcinoma (at protein level), as well as in other tumors, including pheochromocytomas and paragangliomas.
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Nucleus and Secreted. Secretory granules of pancreatic islets, adrenal gland, pituitary and brain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Carboxypeptidase E antibody
    • Carboxypeptidase H antibody
    • Carboxypeptidase H precursor antibody
    • CarboxypeptidaseE antibody
    • CarboxypeptidaseH antibody
    • CBPE_HUMAN antibody
    • Cobalt stimulated chromaffin granule carboxypeptidase antibody
    • CPE antibody
    • Cph 1 antibody
    • CPH antibody
    • Enkephalin convertase antibody
    • Entephalin convertase antibody
    • Insulin granule associated carboxypeptidase antibody
    • Prohormone processing carboxypeptidase antibody
    • Prohormone-processing carboxypeptidase antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling CPE with ab84631 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of cell bodies and processes of pinealocytes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - CPE. Right - Merge.

  • Anti-CPE antibody (ab84631) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 53 kDa
    Observed band size: 53 kDa



    12% gel
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human brain, cerebellum tissue labelling CPE with ab84631 at 5µg/ml.

References

ab84631 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84631.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up