Overview

  • Product name

  • Description

    Rabbit polyclonal to CPEB2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CPEB2 aa 205-254.
    Sequence:

    NTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHS


    Database link: Q7Z5Q1

  • Positive control

    • WB: RT4 and U-251 MG cell lysates. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 65 kDa.

Target

  • Relevance

    CPEB2, (Cytoplasmic polyadenylation element-binding protein 2), belongs to the RRM CPEB family and contains 2 RRM (RNA recognition motif) domains. It may bind poly(U) RNA oligomers. It may play a role in translational regulation of stored mRNAs in transcriptionally inactive haploid spermatids. There are 7 named isoforms [FASTA] produced by alternative splicing.
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CPE binding protein 2 antibody
    • CPE BP2 antibody
    • CPEB 2 antibody
    • CPEBP2 antibody
    • Cytoplasmic polyadenylation element binding protein 2 antibody
    • hCPEB 2 antibody
    • hCPEB2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CPEB2 (green) using ab222070 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-CPEB2 antibody (ab222070) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 65 kDa

References

ab222070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up