Overview

  • Product name

  • Description

    Sheep polyclonal to CPLX1
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Cow, Human, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human CPLX1 aa 1-134. (Derived from E.coli).
    Sequence:

    MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKA KYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK


    Database link: O14810

  • Positive control

    • Mouse brain tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab215066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 18 kDa (predicted molecular weight: 15 kDa).

Target

Images

References

ab215066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up