Overview

  • Product name

  • Description

    Rabbit polyclonal to CPLX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CPLX1 aa 1-134. (Expressed in E.coli)
    Sequence:

    MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKA KYAKMEAEREAVRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKA IPPGCGDEVEEEDESILDTVIKYLPGPLQDMLKK


    Database link: O14810

  • Positive control

    • IHC-P: Human brain tissue. WB: Recombinant human CPLX1 protein. Mouse and rat cerebrum lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab231347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

Images

  • Anti-CPLX1 antibody (ab231347) at 2 µg/ml + Mouse cerebrum lysate.

    Predicted band size: 15 kDa

  • Anti-CPLX1 antibody (ab231347) at 2 µg/ml + Rat cerebrum lysate.

    Predicted band size: 15 kDa

  • Anti-CPLX1 antibody (ab231347) at 2 µg/ml + Recombinant human CPLX1 protein.

    Predicted band size: 15 kDa

  • Formalin-fixed, paraffin-embedded human brain tissue stained for CPLX1 using ab231347 at 20µg/ml in immunohistochemical analysis, DAB staining.

References

ab231347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up