Overview

  • Product name

  • Description

    Sheep polyclonal to CPLX2
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Cow, Human, Torpedo
  • Immunogen

    Recombinant full length protein corresponding to Human CPLX2 aa 1-134. Expressed in E .coli.
    Sequence:

    MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA KHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKA IPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK


    Database link: Q6PUV4

  • Positive control

    • Mouse brain tissue lysate.

Properties

  • Form

    Lyophilised:Reconstitute the antibody with 100 uL sterile PBS and the final concentration is 500 ug/mL. Reconstituted antibody can be aliquoted and stored frozen at < -20 °C for at least for six months without detectable loss of activity.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    The IgG fraction of immunized serum was purified by antigen affinity chromatography and lyophilized from a 0.2 µm filtered solution in phosphate-buffered saline (PBS).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab215046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 15 kDa.

Target

  • Function

    Positively regulates a late step in synaptic vesicle exocytosis. Also involved in mast cell exocytosis.
  • Tissue specificity

    Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum from patients with schizophrenia.
  • Sequence similarities

    Belongs to the complexin/synaphin family.
  • Cellular localization

    Cytoplasm > cytosol. Enriched at synaptic-releasing sites in mature neurons.
  • Information by UniProt
  • Database links

  • Alternative names

    • 921 L antibody
    • Complexin 2 antibody
    • Complexin II antibody
    • Complexin-2 antibody
    • Complexin2 antibody
    • ComplexinII antibody
    • CPLX 2 antibody
    • Cplx2 antibody
    • CPLX2_HUMAN antibody
    • CPX 2 antibody
    • CPX II antibody
    • CPXII antibody
    • Hfb1 antibody
    • Synaphin 1 antibody
    • Synaphin-1 antibody
    • Synaphin1 antibody
    see all

Images

  • Anti-CPLX2 antibody (ab215046) at 1/1000 dilution + mouse brain tissue lysate

    Predicted band size: 15 kDa

References

ab215046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up