Overview

  • Product name

  • Description

    Rabbit polyclonal to CPLX2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Cow, Human
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Mouse CPLX2 aa 1-134. (Expressed in E.coli).
    Sequence:

    MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA KHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKA IPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK


    Database link: P84086

  • Positive control

    • WB: Recombinant mouse CPLX2 protein; Mouse and rat cerebrum and cerebellum lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab232868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function

    Positively regulates a late step in synaptic vesicle exocytosis. Also involved in mast cell exocytosis.
  • Tissue specificity

    Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum from patients with schizophrenia.
  • Sequence similarities

    Belongs to the complexin/synaphin family.
  • Cellular localization

    Cytoplasm > cytosol. Enriched at synaptic-releasing sites in mature neurons.
  • Information by UniProt
  • Database links

  • Alternative names

    • 921 L antibody
    • Complexin 2 antibody
    • Complexin II antibody
    • Complexin-2 antibody
    • Complexin2 antibody
    • ComplexinII antibody
    • CPLX 2 antibody
    • Cplx2 antibody
    • CPLX2_HUMAN antibody
    • CPX 2 antibody
    • CPX II antibody
    • CPXII antibody
    • Hfb1 antibody
    • Synaphin 1 antibody
    • Synaphin-1 antibody
    • Synaphin1 antibody
    see all

Images

  • Anti-CPLX2 antibody (ab232868) at 2 µg/ml + Recombinant mouse CPLX2 protein

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232868) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232868) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232868) at 2 µg/ml + Mouse cerebellum lysate

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232868) at 2 µg/ml + Rat cerebellum lysate

    Predicted band size: 15 kDa

References

ab232868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up