Overview

  • Product name
  • Description
    Rabbit polyclonal to CPLX2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human CPLX2 aa 2-134. (Expressed in E.coli).
    Sequence:

    DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAK HARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAI PAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK


    Database link: Q6PUV4

  • Positive control
    • IHC-P: Human brain tissue. WB: Rat spinal cord and cerebrum lysates; Mouse cerebrum lysate; Recombinant human CPLX2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function
    Positively regulates a late step in synaptic vesicle exocytosis. Also involved in mast cell exocytosis.
  • Tissue specificity
    Nervous system. In hippocampus and cerebellum, expressed mainly by excitatory neurons. Down-regulated in brain cortex from patients suffering from Huntington disease, bipolar disorder or major depression. Down-regulated in cerebellum from patients with schizophrenia.
  • Sequence similarities
    Belongs to the complexin/synaphin family.
  • Cellular localization
    Cytoplasm > cytosol. Enriched at synaptic-releasing sites in mature neurons.
  • Information by UniProt
  • Database links
  • Alternative names
    • 921 L antibody
    • Complexin 2 antibody
    • Complexin II antibody
    • Complexin-2 antibody
    • Complexin2 antibody
    • ComplexinII antibody
    • CPLX 2 antibody
    • Cplx2 antibody
    • CPLX2_HUMAN antibody
    • CPX 2 antibody
    • CPX II antibody
    • CPXII antibody
    • Hfb1 antibody
    • Synaphin 1 antibody
    • Synaphin-1 antibody
    • Synaphin1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human brain tissue stained for CPLX2 using ab232895 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CPLX2 antibody (ab232895) at 2 µg/ml + Recombinant human CPLX2 protein

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232895) at 2 µg/ml + Rat spinal cord lysate

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232895) at 2 µg/ml + Rat cerebrum lysate

    Predicted band size: 15 kDa

  • Anti-CPLX2 antibody (ab232895) at 2 µg/ml + Mouse cerebrum lysate

    Predicted band size: 15 kDa

References

ab232895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up