Overview

  • Product name

  • Description

    Rabbit polyclonal to CPN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human CPN1 aa 159-325. Expressed in E.coli. N-terminal tag.
    Sequence:

    LNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFN FVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVY SYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLE LSCDKFPPEEELQREWL


    Database link: P15169

  • Positive control

    • IHC-P: Human liver tissue. WB: A549 cell lysate; Recombinant human CPN1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232802 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 52 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Protects the body from potent vasoactive and inflammatory peptides containing C-terminal Arg or Lys (such as kinins or anaphylatoxins) which are released into the circulation.
  • Tissue specificity

    Synthesized in the liver and secreted in plasma.
  • Involvement in disease

    Defects in CPN1 are the cause of carboxypeptidase N deficiency (CPND) [MIM:212070]. Patients affected present some combination of angioedema or chronic urticaria, as well as hay fever or astma, and have also slightly depressed serum carboxy peptidase N, suggestive of autosomal recessive inheritance of this disorder.
  • Sequence similarities

    Belongs to the peptidase M14 family.
  • Cellular localization

    Secreted > extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACBP antibody
    • Anaphylatoxin inactivator antibody
    • Arginine carboxypeptidase antibody
    • Carboxypeptidase N catalytic chain antibody
    • Carboxypeptidase N polypeptide 1 50 kD antibody
    • Carboxypeptidase N polypeptide 1 antibody
    • Carboxypeptidase N small subunit antibody
    • Carboxypeptidase N subunit 1 antibody
    • CBPN_HUMAN antibody
    • CPN antibody
    • CPN1 antibody
    • Kininase 1 antibody
    • Kininase-1 antibody
    • Kininase1 antibody
    • Lysine carboxypeptidase antibody
    • Plasma carboxypeptidase B antibody
    • SCPN antibody
    • Serum carboxypeptidase N antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CPN1 using ab232802 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CPN1 antibody (ab232802) at 2 µg/ml + A549 (human lung carcinoma cell line) cell lysate

    Predicted band size: 52 kDa

  • Anti-CPN1 antibody (ab232802) at 2 µg/ml + Recombinant human CPN1 protein

    Predicted band size: 52 kDa

References

ab232802 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up