Overview

  • Product name

  • Description

    Rabbit polyclonal to CPNE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human CPNE1 aa 70-119 (N terminal). The exact sequence is proprietary.
    Sequence:

    TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG


    Database link: Q99829

  • Positive control

    • HepG2 cell lysate. Human intestine.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab66898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 5 µg/ml. Detects a band of approximately 57 kDa (predicted molecular weight: 59 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/312500.

IHC-P Use a concentration of 4 - 8 µg/ml.

Target

Images

  • All lanes : Anti-CPNE1 antibody (ab66898) at 5 µg/ml (in 5% skim milk / PBS buffer)

    Lane 1 : Molecular weight markers
    Lane 2 : HepG2 cell lysate at 10 µg

    Secondary
    All lanes : HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 59 kDa
    Observed band size: 57 kDa
    why is the actual band size different from the predicted?
    Additional bands at: 25 kDa. We are unsure as to the identity of these extra bands.



    Gel concentration 12%.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human intestine tissue labelling CPNE1 with ab66898 at 4-8µg/ml. Arrows indicate positively labelled epithelial cells of the intestinal villus. Magnification: 400X.

References

ab66898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab66898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up