Overview

  • Product name

  • Description

    Rabbit polyclonal to CRABP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Chicken, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human CRABP1 aa 2-137.
    Sequence:

    PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQF YIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLL EGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE


    Database link: P29762

  • Positive control

    • WB: NIH/3T3 whole cell lysate; Mouse ocular lysate. IHC-P: Human breast cancer and thyroid tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 15 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-CRABP1 antibody (ab235838) at 1/500 dilution

    Lane 1 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate
    Lane 2 : Mouse ocular lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 15 kDa

  • Paraffin-embedded human breast cancer tissue stained for CRABP1 using ab235838 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for CRABP1 using ab235838 at 1/100 dilution in immunohistochemical analysis.

References

ab235838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up