Overview

  • Product name
  • Description
    Rabbit polyclonal to CRABP2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, Immunoelectrophoresis, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CRABP2 aa 1-138. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDT FYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKL LKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE


    Database link: P29373

  • Positive control
    • IHC-P: Human prostate, liver, glioma and kidney tissue. WB: Recombinant Human CRABP2 protein (ab74527), Recombinant human CRABP2 protein; MCF7 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab232879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
Immunoelectrophoresis Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function
    Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization
    Cytoplasm. Nucleus. Upon ligand binding, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cellular retinoic acid binding protein 2 antibody
    • Cellular retinoic acid binding protein II antibody
    • Cellular retinoic acid-binding protein 2 antibody
    • Cellular retinoic acid-binding protein II antibody
    • CRABP II antibody
    • CRABP-II antibody
    • Crabp2 antibody
    • CRABPII antibody
    • RABP2_HUMAN antibody
    • RBP6 antibody
    • Rretinoic acid-binding protein, cellular, type II antibody
    see all

Images

  • Anti-CRABP2 antibody (ab232879) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CRABP2 using ab232879 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for CRABP2 using ab232879 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CRABP2 using ab232879 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for CRABP2 using ab232879 at 10 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Anti-CRABP2 antibody (ab232879) at 2 µg/ml + Recombinant human CRABP2 protein

References

ab232879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up