Overview

  • Product name

  • Description

    Rabbit polyclonal to CRABP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC - Wholemountmore details
  • Species reactivity

    Reacts with: Zebrafish
  • Immunogen

    Recombinant full length protein corresponding to Zebrafish CRABP2 aa 1-142.
    Sequence:

    MDRKIPDFAGTWKMKSSENFEELLKALGVNVMLRKIAVAAASKPSVEITQ EGETLTIKTSTSVRTTNVTFTVGQEFNEATVDGRPCTSFPRWVTDSKISC EQTLQKGEGPKTSWTREITNDAELILTMTADDVVCTRVYVRE


    Database link: Q801Y4

  • Positive control

    • WB: Zebrafish eye lysate. IHC-Wm: 1 day-post-fertilization zebrafish embryo.

Properties

Applications

Our Abpromise guarantee covers the use of ab233124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 16 kDa.
IHC - Wholemount 1/50 - 1/500.

Target

  • Function

    Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
  • Cellular localization

    Cytoplasm. Nucleus. Upon ligand binding, a conformation change exposes a nuclear localization motif and the protein is transported into the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular retinoic acid binding protein 2 antibody
    • Cellular retinoic acid binding protein II antibody
    • Cellular retinoic acid-binding protein 2 antibody
    • Cellular retinoic acid-binding protein II antibody
    • CRABP II antibody
    • CRABP-II antibody
    • Crabp2 antibody
    • CRABPII antibody
    • RABP2_HUMAN antibody
    • RBP6 antibody
    • Rretinoic acid-binding protein, cellular, type II antibody
    see all

Images

  • Anti-CRABP2 antibody (ab233124) at 1/1000 dilution + Zebrafish eye lysate at 30 µg

    Predicted band size: 16 kDa



    15% SDS-PAGE

  • 1 day-post-fertilization zebrafish embryo stained for CRABP2 using ab233124 at 1/50 dilution in wholemount immunohistochemical analysis.

References

ab233124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up