Overview

  • Product name

  • Description

    Rabbit polyclonal to CRALBP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Pig
    Predicted to work with: Cow, Human
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CRALBP aa 1-317. (Expressed in E.coli).
    Sequence:

    MSEGVGTFRMVPEEEQELRAQLEQLTTKDHGPVFGPCSQLPRHTLQKAKD ELNEREETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFI RARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSS RDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCI IENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTT YNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKA VAEQLFGPQAQAENTAF


    Database link: P12271

  • Positive control

    • WB: Pig and mouse eye lysates; Recombinant human CRALBP protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231967 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 36 kDa.

Target

  • Function

    Soluble retinoid carrier essential the proper function of both rod and cone photoreceptors. Participates in the regeneration of active 11-cis-retinol and 11-cis-retinaldehyde, from the inactive 11-trans products of the rhodopsin photocycle and in the de novo synthesis of these retinoids from 11-trans metabolic precursors. The cycling of retinoids between photoreceptor and adjacent pigment epithelium cells is known as the 'visual cycle'.
  • Tissue specificity

    Retina and pineal gland. Not present in photoreceptor cells but is expressed abundantly in the adjacent retinal pigment epithelium (RPE) and in the Mueller glial cells of the retina.
  • Involvement in disease

    Defects in RLBP1 are a cause of retinitis pigmentosa autosomal recessive (ARRP) [MIM:268000]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
    Defects in RLBP1 are the cause of Bothnia retinal dystrophy (BRD) [MIM:607475]; also known as Vasterbotten dystrophy. Affected individuals show night blindness from early childhood with features consistent with retinitis punctata albescens and macular degeneration.
    Defects in RLBP1 are the cause of rod-cone dystrophy Newfoundland (NFRCD) [MIM:607476]. NFRCD is a retinal dystrophy reminiscent of retinitis punctata albescens but with a substantially lower age at onset and more-rapid and distinctive progression. Rod-cone dystrophies results from initial loss of rod photoreceptors, later followed by cone photoreceptors loss.
    Defects in RLBP1 are a cause of fundus albipunctatus (FA) [MIM:136880]. FA is a rare form of stationary night blindness characterized by a delay in the regeneration of cone and rod photopigments.
  • Sequence similarities

    Contains 1 CRAL-TRIO domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cellular retinaldehyde binding protein 1 antibody
    • Cellular retinaldehyde binding protein antibody
    • Cellular retinaldehyde-binding protein antibody
    • MGC3663 antibody
    • Retinaldehyde binding protein 1 antibody
    • Retinaldehyde-binding protein 1 antibody
    • RLBP 1 antibody
    • RLBP1 antibody
    • RLBP1_HUMAN antibody
    see all

Images

  • All lanes : Anti-CRALBP antibody (ab231967) at 3 µg/ml

    Lane 1 : Mouse eye lysate
    Lane 2 : Pig eye lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 36 kDa

  • Anti-CRALBP antibody (ab231967) at 5 µg/ml + Pig eye lysate

    Predicted band size: 36 kDa

  • Anti-CRALBP antibody (ab231967) at 5 µg/ml + Recombinant human CRALBP protein

    Predicted band size: 36 kDa

References

ab231967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up