Anti-Cre recombinase antibody (ab216262)
Key features and details
- Rabbit polyclonal to Cre recombinase
- Suitable for: WB, ICC/IF, Flow Cyt
- Isotype: IgG
Overview
-
Product name
Anti-Cre recombinase antibody
See all Cre recombinase primary antibodies -
Description
Rabbit polyclonal to Cre recombinase -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, Flow Cytmore details -
Immunogen
Recombinant fragment corresponding to Bacteriophage P1 Cre recombinase aa 1-180. The immunogen was tagged with a 6xHis tag and an S tag.
Sequence:MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCR SWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHR RSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLME NSDRCQDIRNLAFLGIAYNTLLRIAEIARI
Database link: P06956 -
Positive control
- 293T transfected with GFP-Cre recombinase; Human 293T cells transfected with GFP-Cre recombinase lysate;
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide -
Concentration information loading... -
Purity
Whole antiserum -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab216262 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/2000. Predicted molecular weight: 39 kDa. | |
| ICC/IF | 1/1000 - 1/2000. Use antigen retrieval with microwave boiling for 7 minutes in 10mM Tris HCl, pH 9. |
|
| Flow Cyt | 1/200. |
Target
-
Relevance
Cre-recombinase is a 38 kDa DNA recombinase derived from the P1 bacteriophage. It is highly specific for a 34 bp DNA sequence (loxP) found in P1 DNA. It catalyzes site-specific recombination between two 34-base-pair LOXP sites. Its role is to maintain the phage genome as a monomeric unit-copy plasmid in the lysogenic state. It is homotetramer when bound to DNA and belongs to the "phage" integrase family. -
Alternative names
- Cre antibody
- Cyclization recombinase antibody
- Recombinase cre antibody
Images
-
Western blot - Anti-Cre recombinase antibody (ab216262)All lanes : Anti-Cre recombinase antibody (ab216262) at 1/2000 dilution
Lane 1 : Human 293T cell lysate
Lane 2 : Human 293T cells transfected with GFP-Cre recombinase lysate
Lysates/proteins at 40 µg per lane.
Predicted band size: 39 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-Cre recombinase antibody (ab216262)Immunocytochemistry analysis of formalin fixed and paraffin-embedded 239T transfected with empty vector (left) or with GFP-Cre recombinase (right) labeling Cre recombinase using ab216262 at 1/1000 dilution, after antigen retrieval.
-
Immunocytochemistry/ Immunofluorescence - Anti-Cre recombinase antibody (ab216262)Immunofluorescent analysis of formalin fixed 293T cells transfected with GFP-Cre recombinase (green) and incubated with ab216262 at 1/2000 dilution (red). DAPI staining is shown in blue.
-
Flow Cytometry - Anti-Cre recombinase antibody (ab216262)Flow cytometric analysis of formalin fixed 293T non transfected (top) or transfected with GFP-Cre recombinase (bottom) labeling Cre recombinase using ab216262 at 1/200 dilution, followed by Alexa 647 conjugated secondary antibody detection.
Protocols
Datasheets and documents
References (0)
ab216262 has not yet been referenced specifically in any publications.
