Overview

  • Product name

    Anti-Cre recombinase antibody
    See all Cre recombinase primary antibodies
  • Description

    Rabbit polyclonal to Cre recombinase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, Flow Cytmore details
  • Immunogen

    Recombinant fragment corresponding to Bacteriophage P1 Cre recombinase aa 1-180. The immunogen was tagged with a 6xHis tag and an S tag.
    Sequence:

    MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCR SWAAWCKLNNRKWFPAEPEDVRDYLLYLQARGLAVKTIQQHLGQLNMLHR RSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLME NSDRCQDIRNLAFLGIAYNTLLRIAEIARI


    Database link: P06956

  • Positive control

    • 293T transfected with GFP-Cre recombinase; Human 293T cells transfected with GFP-Cre recombinase lysate;

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab216262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 39 kDa.
ICC/IF 1/1000 - 1/2000.

Use antigen retrieval with microwave boiling for 7 minutes in 10mM Tris HCl, pH 9.

Flow Cyt 1/200.

Target

  • Relevance

    Cre-recombinase is a 38 kDa DNA recombinase derived from the P1 bacteriophage. It is highly specific for a 34 bp DNA sequence (loxP) found in P1 DNA. It catalyzes site-specific recombination between two 34-base-pair LOXP sites. Its role is to maintain the phage genome as a monomeric unit-copy plasmid in the lysogenic state. It is homotetramer when bound to DNA and belongs to the "phage" integrase family.
  • Alternative names

    • Cre antibody
    • Cyclization recombinase antibody
    • Recombinase cre antibody

Images

  • All lanes : Anti-Cre recombinase antibody (ab216262) at 1/2000 dilution

    Lane 1 : Human 293T cell lysate
    Lane 2 : Human 293T cells transfected with GFP-Cre recombinase lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 39 kDa

  • Immunocytochemistry analysis of formalin fixed and paraffin-embedded 239T transfected with empty vector (left) or with GFP-Cre recombinase (right) labeling Cre recombinase using ab216262 at 1/1000 dilution, after antigen retrieval. 

  • Immunofluorescent analysis of formalin fixed 293T cells transfected with GFP-Cre recombinase (green) and incubated with ab216262 at 1/2000 dilution (red). DAPI staining is shown in blue.

  • Flow cytometric analysis of formalin fixed 293T non transfected (top) or transfected with GFP-Cre recombinase (bottom) labeling Cre recombinase using ab216262 at 1/200 dilution, followed by Alexa 647 conjugated secondary antibody detection. 

References

ab216262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Frozen Retina Sections)
Permeabilization
Yes - 0.05% Triton X
Specification
Frozen Retina Sections
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Oct 10 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up