Overview

  • Product name

    Anti-Creatine Kinase MM antibody
    See all Creatine Kinase MM primary antibodies
  • Description

    Rabbit polyclonal to Creatine Kinase MM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Dog
    Predicted to work with: Rat, Rabbit, Chicken, Cow, Human, Pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Dog Creatine Kinase MM aa 11-367. Expressed in E.coli. N-terminal tag.
    Sequence:

    MGHHHHHHSGSEF-KLNYKPEEEYPDLTKHNNHMAKALTPEIYKKLRDKE TPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYQVFKDLFDPIIQDR HGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHC SRGERRAVEKLSIEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDK PVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNM KEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVH VKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDISNADRLGSSE VEQVQLVVDGVKLMVEMEKKL


    Database link: P05123

  • Positive control

    • WB: Mouse brain and heart lysate. Canine brain and heart lysate. Recombinant canine Creatine Kinase MM protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml.

Target

Images

  • Anti-Creatine Kinase MM antibody (ab231200) at 2 µg/ml + Canine heart lysate
  • Anti-Creatine Kinase MM antibody (ab231200) at 2 µg/ml + Canine brain lysate
  • Anti-Creatine Kinase MM antibody (ab231200) at 2 µg/ml + Mouse heart lysate
  • Anti-Creatine Kinase MM antibody (ab231200) at 2 µg/ml + Mouse brain lysate
  • Anti-Creatine Kinase MM antibody (ab231200) at 2 µg/ml + Recombinant canine Creatine Kinase MM protein

References

ab231200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up