Overview

  • Product name

    Anti-Creatine Kinase MM antibody
    See all Creatine Kinase MM primary antibodies
  • Description

    Rabbit polyclonal to Creatine Kinase MM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Human
  • Immunogen

    Recombinant fragment corresponding to Pig Creatine Kinase MM aa 11-367.
    Sequence:

    MPFGNTHNKYKLNFKAEEEYPDLSKHNNHMAKALTLEIYKKLRDKETPSG FTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYVVFKDLFDPIIQDRHGGY KPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGE RRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSP LLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVF RRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKL


    Database link: Q5XLD3

  • Positive control

    • IHC-P: Pic cardiac muscle and skeletal muscle tissue. WB: Recombinant pig Creatine Kinase MM protein; Pig brain, heart and muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 43 kDa.

Target

Images

  • All lanes : Anti-Creatine Kinase MM antibody (ab233201) at 3 µg/ml

    Lane 1 : Pig brain tissue lysate.
    Lane 2 : Pig heart tissue lysate.
    Lane 3 : Pig muscle tissue lysate.

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 43 kDa

  • Anti-Creatine Kinase MM antibody (ab233201) at 2 µg/ml + Recombinant pig Creatine Kinase MM protein.

    Predicted band size: 43 kDa

  • Formalin-fixed, paraffin-embedded Pig skeletal muscle tissue stained for Creatine Kinase MM using ab233201 at 20ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded Pig cardiac muscle tissue stained for Creatine Kinase MM using ab233201 at 20ug/ml in immunohistochemical analysis. DAB staining.

References

ab233201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up