Overview

  • Product name

    Anti-Creatine Kinase MM antibody (HRP)
    See all Creatine Kinase MM primary antibodies
  • Description

    Rabbit polyclonal to Creatine Kinase MM (HRP)
  • Host species

    Rabbit
  • Conjugation

    HRP
  • Tested applications

    Suitable for: WB, IHC-P, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human Creatine Kinase MM aa 1-381.
    Sequence:

    MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSG FTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGY KPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGE RRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSP LLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVF RRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK


    Database link: P06732

  • Positive control

    • 293T whole cell lysate (ab95494) can be used as a positive control in WB.

Properties

Applications

Our Abpromise guarantee covers the use of ab193292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Detects a band of approximately 42 kDa (predicted molecular weight: 43 kDa).
IHC-P Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.

Target

Images

  • Anti-Creatine Kinase MM antibody (HRP) (ab193292) at 2 µg/ml + 293T whole cell lysate

    Secondary
    Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 43 kDa
    Additional bands at: 42 kDa. We are unsure as to the identity of these extra bands.

References

ab193292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up