Overview

  • Product name
    Anti-CREB3L1 / OASIS antibody
    See all CREB3L1 / OASIS primary antibodies
  • Description
    Rabbit polyclonal to CREB3L1 / OASIS
  • Host species
    Rabbit
  • Specificity
    ab33051 recognises CREB3L1 / OASIS.
  • Tested applications
    Suitable for: ELISA, WB, IHC (PFA fixed), IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human CREB3L1/ OASIS aa 43-92 (N terminal).
    Sequence:

    FTENMEDFSNDLFSSFFDDPVLDEKSPLLDMELDSPTPGIQAEHSYSLSG

  • Positive control
    • Fetal small intestine lysate.
  • General notes

    Previously labelled as CREB3L1. 

    Previously labelled as CREB3L1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab33051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/1.5625e+006.
WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 57 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC (PFA fixed) Use at an assay dependent concentration. PubMed: 25359725
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Function
    Transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Specifically involved in ER-stress response in astrocytes in the central nervous system (By similartity). May play a role in gliosis. In vitro, binds to box-B element, cAMP response element (CRE) and CRE-like sequences, and activates transcription through box-B element but not through CRE.
  • Tissue specificity
    Ubiquitously expressed with high levels in pancreas and prostate. Expressed at relatively lower levels in brain.
  • Sequence similarities
    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • Post-translational
    modifications
    Controlled by regulated intramembrane proteolysis (RIP). Following ER stress a fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage is performed sequentially by site-1 and site-2 proteases (PS1 and PS2) and is triggered by translocation to the Golgi apparatus.
  • Cellular localization
    Endoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • BBF-2 homolog antibody
    • CAMP responsive element binding protein 3 like 1 antibody
    • cAMP-responsive element-binding protein 3-like protein 1 antibody
    • CR3L1_HUMAN antibody
    • Creb3l1 antibody
    • Cyclic AMP responsive element binding protein 3 like protein 1 antibody
    • OASIS antibody
    • Old astrocyte specifically-induced substance antibody
    • Processed cyclic AMP-responsive element-binding protein 3-like protein 1 antibody
    see all

Images

  • Anti-CREB3L1 / OASIS antibody (ab33051) at 1.25 µg/ml (in 5% skim milk / PBS buffer) + fetal small intestine lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 57 kDa
    Observed band size: 50 kDa
    why is the actual band size different from the predicted?



    Gel concetration: 12%
  • ab33051 staining CREB3L1 / OASIS in murine liver tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).Tissue was fixed in formaldehyde and a heat mediated antigen retrieval step was performed. Samples were then blocked using 1.5% serum for 1 hour at 25°C and then incubated with ab33051 at a 1/800 dilution for 18 hours at 4°C. The secondary used was an undiluted HRP conjugated polyclonal.

    See Abreview

  • Immunofluorescence analysis of U2-OS, staining CREB3L1 / OASIS with ab33051.

    Cells were fixed with formaldehyde, permeabilized with 0.5% NP-40 in PBS and blocked with 3% BSA for 1 hour at 25°C. Samples were incubated with primary antibody (1/100 in 3% BSA in PBS) for 12 hours at 4°C. An AlexaFluor®546-conjugated goat anti-rabbit polyclonal IgG (1/200) was used as the secondary antibody.

    See Abreview

References

This product has been referenced in:
  • Keller RB  et al. Monoallelic and biallelic CREB3L1 variant causes mild and severe osteogenesis imperfecta, respectively. Genet Med 20:411-419 (2018). WB . Read more (PubMed: 28817112) »
  • Zhu HY  et al. Up-regulation of FGFBP1 signaling contributes to miR-146a-induced angiogenesis in human umbilical vein endothelial cells. Sci Rep 6:25272 (2016). WB . Read more (PubMed: 27121396) »
See all 4 Publications for this product

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (Vascular smooth muscle cells)
Gel Running Conditions
Reduced Denaturing
Loading amount
30 µg
Specification
Vascular smooth muscle cells
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted Oct 31 2017

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (U2OS)
Permeabilization
Yes - 0.5% NP40/PBS
Specification
U2OS
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Sep 25 2012

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (primary vascular smooth muscle cells)
Permeabilization
Yes - 0.5% NP-40
Specification
primary vascular smooth muscle cells
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
Fixative
Methanol/Acetone

Leilani Beltran

Verified customer

Submitted Mar 22 2012

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Liver)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Vector Labs Unmasking Solution H-3300
Permeabilization
No
Specification
Liver
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1.5% · Temperature: 25°C
Fixative
Formaldehyde

Leilani Beltran

Verified customer

Submitted Mar 20 2012

Answer

Thank you for your query and I am very sorry for the delay in getting back to you.


The antibody which your customer is interested in, anti-CREB3L1 antibody (ab33051), was raised against a peptide taken from the amino acid residues 43-92 of human CREB3L1.


This antibody has to our knowledge not been used with mouse or rat samples as yet but due to the sequence homology of the protein from these speciesto the immunogen used, the antibody would be predicted to react. The rat protein shares 96% and the mouse protein 94% homology to the immunogen in the region of the immunogen used.


If your customer would be interested in applying for atesting discount using this antibody I would be happy to help. More information on this offer can be found from the following link:


https://www.abcam.com/collaboratordiscount


If they would like to participate in this scheme please do let me know as a discount code needs to be issued prior to purchase.

Read More
Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Human Cell lysate - whole cell (SAOS-2, U2OS, HEK 293T, ATDC5)
Gel Running Conditions
Reduced Denaturing (10% gel)
Loading amount
15 µg
Treatment
0.02 ug/ml tunicamycin for 72h
Specification
SAOS-2, U2OS, HEK 293T, ATDC5
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Leilani Beltran

Verified customer

Submitted Nov 25 2011

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up