Overview

  • Product name

  • Description

    Rabbit polyclonal to CREBRF/LRF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CREBRF/LRF aa 79-217.
    Sequence:

    DNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGLDDFSSPYQ DEEVISKTPTLAQLNSEDSQSVSDSLYYPDSLFSVKQNPLPSSFPGKKIT SRAAAPVCSSKTLQAEVPLSDCVQKASKPTSSTQIMVKT


    Database link: Q8IUR6

  • Positive control

    • SK-MEL-30 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 4 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Acts as a negative regulator of the endoplasmic reticulum stress response or unfolded protein response (UPR). Represses the transcriptional activity of CREB3 during the UPR. Recruits CREB3 into nuclear foci.
  • Sequence similarities

    Belongs to the bZIP family. CREBRF subfamily.
    Contains 1 bZIP (basic-leucine zipper) domain.
  • Post-translational
    modifications

    Probably degraded by the proteasome.
  • Cellular localization

    Nucleus. Colocalizes with CREB3 in nuclear foci.
  • Information by UniProt
  • Database links

  • Alternative names

    • adult retina protein antibody
    • C5orf41 antibody
    • Chromosome 5 Open Reading Frame 41 antibody
    • CREB3 regulatory factor antibody
    • CREBRF antibody
    • CRERF_HUMAN antibody
    • Hypothetical protein antibody
    • LRF antibody
    • Luman recruitment factor antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SK-MEL-30 cells labeling LOC153222 with ab219968 at 4 µg/ml (green).

References

ab219968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Cell lysate - whole cell (Neuro2a cells)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
60 µg
Treatment
MG132 (10 uM) for 12h
Specification
Neuro2a cells
Blocking step
Serum as blocking agent for 1 hour(s) and 15 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 22 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up