Overview

  • Product name
  • Description
    Rabbit polyclonal to CRES
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CRES aa 1-142.
    Sequence:

    MPRCRWLSLILLTIPLALVARKDPKKNETGVLRKLKPVNASNANVKQCLW FAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLS TNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA


    Database link: O60676

  • Positive control
    • Testis lysate, HEK293 and DU145 cell line extracts.
  • General notes

     This product was previously labelled as CST8

     

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab175247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 16 kDa.

Target

  • Function
    Performs a specialized role during sperm development and maturation.
  • Tissue specificity
    Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • CRES antibody
    • CST 8 antibody
    • Cst8 antibody
    • CST8_HUMAN antibody
    • cystatin 8 (cystatin related epididymal specific) antibody
    • Cystatin 8 antibody
    • Cystatin related epididymal specific antibody
    • Cystatin related epididymal specific protein antibody
    • Cystatin related epididymal spermatogenic protein antibody
    • Cystatin related protein epididymis specific antibody
    • Cystatin-8 antibody
    • Cystatin-related epididymal spermatogenic protein antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling CRES with ab175247 at 1/200. Magnification: 200x.

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab175247. Blue DAPI for nuclear staining.
  • All lanes : Anti-CRES antibody (ab175247) at 1/500 dilution

    Lane 1 : Testis tissue lysate
    Lane 2 : HEK293 cell line lysate
    Lane 3 : DU145 cell line lysate

    Predicted band size: 16 kDa

References

ab175247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up