Overview

  • Product name

  • Description

    Chicken polyclonal to CRF
  • Host species

    Chicken
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Dog, Pig
  • Immunogen

    Recombinant fragment corresponding to Human CRF aa 146-196.
    Sequence:

    EAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIG K

  • Positive control

    • E. coli derived CRF fusion protein.
  • General notes

     This product was previously labelled as Corticotropin Releasing Factor , Corticotropin Releasing Factor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab80360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/3000. Predicted molecular weight: 21 kDa.

Target

  • Relevance

    CRF precursor is a 41-amino acid peptide derived from a 196-amino acid preprohormone. CRF is a neuroendocrine hormone secreted by the paraventricular nucleus (PVN) of the hypothalamus and is a key player in the hypothalamic pituitary adrenal axis. It is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. Neuronal CRF is important in a variety of diverse roles including, memory, depression, stress, kidney function, parturition, metabolism and feeding (to mention a few).
  • Cellular localization

    Cytoplasmic and Secreted
  • Database links

  • Alternative names

    • Corticoliberin antibody
    • Corticotropin releasing factor antibody
    • Corticotropin releasing hormone antibody
    • CRF antibody
    • Crh antibody
    • CRH1 antibody
    see all

Images

  • Anti-CRF antibody (ab80360) at 1/3000 dilution + E. coli derived CRF fusion protein at 0.4 µg

    Secondary
    goat-anti-IgY/Fc-HRP at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 21 kDa
    Observed band size: 15 kDa
    why is the actual band size different from the predicted?

References

ab80360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up