Overview

  • Product name

  • Description

    Mouse polyclonal to CRHR2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human CRHR2 aa 1-411.
    Sequence:

    MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTC WPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEP ILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNV IHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFF WMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYE NEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSF QGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRI SFHSIKQTAAV


    Database link: NP_001874.2

  • Positive control

    • CRHR2 transfected 293T cell lysate.
  • General notes

     This product was previously labelled as Corticotropin Releasing Factor Receptor 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab167379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa.

Target

  • Function

    This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. Also binds to urocortin I, II and III. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Corticotropin releasing hormone receptor 2 antibody
    • Corticotropin-releasing factor receptor 2 antibody
    • Corticotropin-releasing hormone receptor 2 antibody
    • CRF 2 antibody
    • CRF 2R antibody
    • CRF R2 antibody
    • CRF RB antibody
    • CRF-R-2 antibody
    • CRF-R2 antibody
    • CRF2 antibody
    • CRF2 receptor beta isoform antibody
    • CRF2R antibody
    • CRFR 2 antibody
    • CRFR-2 antibody
    • CRFR2 antibody
    • CRFR2_HUMAN antibody
    • CRH 2R antibody
    • CRH R2 antibody
    • CRH-R-2 antibody
    • CRH-R2 antibody
    • CRH2R antibody
    • CRHR 2 antibody
    • Crhr2 antibody
    • HM CRF antibody
    see all

Images

  • All lanes : Anti-CRHR2 antibody (ab167379) at 1 µg/ml

    Lane 1 : CRHR2 transfected 293T cell lysate
    Lane 2 : Non transfected lysate

    Lysates/proteins at 50 µg per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 48 kDa

References

ab167379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up