Overview

  • Product name

  • Description

    Rabbit polyclonal to CRHR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CRHR2 aa 55-105 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    AAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDD K


    Database link: Q13324

  • Positive control

    • Rat brain and mouse kidney tissues.
  • General notes

     This product was previously labelled as Corticotropin Releasing Factor Receptor 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

1/50 - 1/200 using a fluorescent secondary antibody.

WB 1/100 - 1/1000. Predicted molecular weight: 48 kDa.

Target

  • Function

    This is a receptor for corticotropin releasing factor. Shows high-affinity CRF binding. Also binds to urocortin I, II and III. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Corticotropin releasing hormone receptor 2 antibody
    • Corticotropin-releasing factor receptor 2 antibody
    • Corticotropin-releasing hormone receptor 2 antibody
    • CRF 2 antibody
    • CRF 2R antibody
    • CRF R2 antibody
    • CRF RB antibody
    • CRF-R-2 antibody
    • CRF-R2 antibody
    • CRF2 antibody
    • CRF2 receptor beta isoform antibody
    • CRF2R antibody
    • CRFR 2 antibody
    • CRFR-2 antibody
    • CRFR2 antibody
    • CRFR2_HUMAN antibody
    • CRH 2R antibody
    • CRH R2 antibody
    • CRH-R-2 antibody
    • CRH-R2 antibody
    • CRH2R antibody
    • CRHR 2 antibody
    • Crhr2 antibody
    • HM CRF antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded mouse kidney tissue labeling CRHR2 with ab203585 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded rat brain tissue labeling CRHR2 with ab203585 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up