Overview

  • Product name

  • Description

    Rabbit polyclonal to CRIF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CRIF1 aa 84-117.
    Sequence:

    ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER


    Database link: Q8TAE8

  • Positive control

    • IHC-P: Human colon tissue. WB: RT4 and U-251 MG cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab244530 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a negative regulator of G1 to S cell cycle phase progression by inhibiting cyclin-dependent kinases. Inhibitory effects are additive with GADD45 proteins but occurs also in the absence of GADD45 proteins. Acts as a repressor of the orphan nuclear receptor NR4A1 by inhibiting AB domain-mediated transcriptional activity. May be involved in the hormone-mediated regulation of NR4A1 transcriptional activity.
  • Tissue specificity

    Widely expressed. Highly expressed in the thyroid gland, heart, lymph nodes, trachea and adrenal tissues. Expressed at lower level in liver skeletal muscle, kidney, pancreas, testis, ovary and stomach. Barely detectable in adrenal adenoma and papillary thyroid cancer.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 39S ribosomal protein L59 mitochondrial antibody
    • CKBBP2 antibody
    • CKbetaBP2 antibody
    • CKII beta associating protein antibody
    • CKII beta binding protein 2 antibody
    • CKII beta-associating protein antibody
    • CR6 interacting factor 1 antibody
    • CR6-interacting factor 1 antibody
    • CRIF1 antibody
    • G45IP_HUMAN antibody
    • GADD45G interacting protein 1 antibody
    • Gadd45gip1 antibody
    • Growth arrest and DNA damage inducible GADD45G interacting protein antibody
    • growth arrest and DNA damage inducible, gamma interacting protein 1 antibody
    • Growth arrest and DNA damage-inducible proteins-interacting protein 1 antibody
    • MGC4667 antibody
    • MGC4758 antibody
    • MRP L59 antibody
    • p53 responsive gene 6 antibody
    • p53 responsive gene 6 protein antibody
    • p53-responsive gene 6 protein antibody
    • Papillomavirus L2 interacting nuclear protein 1 antibody
    • Papillomavirus L2-interacting nuclear protein 1 antibody
    • PLINP 1 antibody
    • PLINP antibody
    • PLINP-1 antibody
    • PLINP1 antibody
    • PRG6 antibody
    see all

Images

  • All lanes : Anti-CRIF1 antibody (ab244530) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
  • Paraffin-embedded human colon tissue stained for CRIF1 using ab244530 at 1/200 dilution in immunohistochemical analysis.

References

ab244530 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244530.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up