Overview

  • Product name

  • Description

    Rabbit polyclonal to CRIM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Mouse CRIM1 aa 895-940 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    IDLEVPMWPTPSENDIIHLPRDMGHLQVDYRDNNRLHPGEDSSLDS


    Database link: Q9JLL0

  • Positive control

    • IHC-P: Rat pancreatic cancer and mouse kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab214292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in CNS development by interacting with growth factors implicated in motor neuron differentiation and survival. May play a role in capillary formation and maintenance during angiogenesis. Modulates BMP activity by affecting its processing and delivery to the cell surface.
  • Tissue specificity

    Expressed in pancreas, kidney, skeletal muscle, lung, placenta, brain, heart, spleen, liver and small intestine. Expressed in blood vessels (at protein level).
  • Sequence similarities

    Contains 4 antistasin-like domains.
    Contains 1 IGFBP N-terminal domain.
    Contains 6 VWFC domains.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AU015004 antibody
    • CRIM 1 antibody
    • CRIM-1 antibody
    • CRIM1 antibody
    • CRIM1_HUMAN antibody
    • Cysteine rich motor neuron 1 protein antibody
    • Cysteine rich repeat containing protein S52 antibody
    • Cysteine rich transmembrane BMP regulator 1 (chordin like) antibody
    • Cysteine rich transmembrane BMP regulator 1 antibody
    • Cysteine-rich motor neuron protein 1 antibody
    • Cysteine-rich repeat-containing protein S52 antibody
    • MGC138194 antibody
    • Processed cysteine rich motor neuron 1 protein antibody
    • Processed cysteine-rich motor neuron 1 protein antibody
    • S52 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat pancreatic cancer tissue, labeling CRIM1 using ab214292 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded mouse kidney tissue, labeling CRIM1 using ab214292 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab214292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up