Overview

  • Product name

  • Description

    Rabbit polyclonal to CRISPLD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CRISPLD2 aa 197-329. T322S.
    Sequence:

    VCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETYTPKPET DEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKD RCKGSTCNRYQCPAGCLNHKAKIFGSLFYESSS


    Database link: Q9H0B8

  • Positive control

    • WB: BEWO cell lysate. IHC-P: Human duodenum tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 13,17,42,51,56 kDa.

Target

  • Function

    Promotes matrix assembly.
  • Sequence similarities

    Belongs to the CRISP family.
    Contains 2 LCCL domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CRISP-11 antibody
    • CRISP11 antibody
    • Crispld2 antibody
    • CRLD2_HUMAN antibody
    • Cysteine-rich secretory protein 11 antibody
    • Cysteine-rich secretory protein LCCL domain-containing 2 antibody
    • DKFZP434B044 antibody
    • LCCL domain-containing cysteine-rich secretory protein 2 antibody
    • LCRISP2 antibody
    • MGC74865 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for CRISPLD2 using ab224136 at 1/200 dilution in immunohistochemical analysis.

  • Anti-CRISPLD2 antibody (ab224136) at 1/100 dilution + BEWO cell lysate

    Developed using the ECL technique.

    Predicted band size: 13,17,42,51,56 kDa

References

ab224136 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up