Overview

  • Product name

    Anti-CRLF3 antibody [OTI2H3]
  • Description

    Mouse monoclonal [OTI2H3] to CRLF3
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human CRLF3 aa 1-442. (NP_057070) produced in HEK-293T cells.
    Sequence:

    MRGAMELEPELLLQEARENVEAAQSYRRELGHRLEGLREARRQIKESASQ TRDVLKQHFNDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIE HGVNTAEDLVREGEIAMLGGVGEENEKLWSFTKKASHIQLDSLPEVPLLV DVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWC KVDDDFTAQDYRLQFRKCTSNHFEDVYVGSETEFIVLHIDPNVDYQFRVC ARGDGRQEWSPWSVPQIGHSTLVPHEWTAGFEGYSLSSRRNIALRNDSES SGVLYSRAPTYFCGQTLTFRVETVGQPDRRDSIGVCAEKQDGYDSLQRDQ AVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEAVTLGTTSNNEGGHF KLRVTISSNNREVVFDWLLDQSCGSLYFGCSFFYPGWKVLVF


    Database link: Q8IUI8

  • Positive control

    • IHC-P: Human spleen tissue. WB: NCI-H460 cell extracts.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI2H3
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

WB 1/500. Predicted molecular weight: 49.6 kDa.

Target

  • Relevance

    CRLF3 (Cytokine receptor-like factor 3) contains one fibronectin type-III domain. It is expressed in skin and squamous cell carcinoma (SCC) and in lesion actinic keratosis (AK).
  • Cellular localization

    Cytoplasmic
  • Database links

  • Alternative names

    • CREME 9 antibody
    • CREME9 antibody
    • CRLF 3 antibody
    • CRLM9 antibody
    • Cytokine receptor like factor 3 antibody
    • Cytokine receptor like molecule 9 antibody
    • Cytokine receptor related protein 4 antibody
    • CYTOR4 antibody
    • FRWS antibody
    • MGC20661 antibody
    • P48 antibody
    • p48.2 antibody
    • Type I cytokine receptor like factor antibody
    • Type I cytokine receptor like factor p48 antibody
    see all

Images

  • Paraffin-embedded human spleen tissue stained for CRLF3 with ab236378 at a 1/500 dilution in immunohistochemical analysis.

  • Anti-CRLF3 antibody [OTI2H3] (ab236378) at 1/500 dilution + NCI-H460 (Human lung cancer cell line) cell extracts at 35 µg

    Predicted band size: 49.6 kDa

References

ab236378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up