Overview

  • Product name

  • Description

    Rabbit polyclonal to CRM1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human CRM1 aa 917-1071. (Expressed in E.coli).
    Sequence:

    TYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGN PVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLR DFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIP EEMCD


    Database link: O14980

  • Positive control

    • WB: HeLa and K562 cell lysate; Human lung lysate; Pig intestine lysate; Recombinant human CRM1 protein. IHC-P: Human liver, kidney and stomach tissues. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab231965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of an nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap. Several viruses, among them HIV-1, HTLV-1 and influenza A use it to export their unspliced or incompletely spliced RNAs out of the nucleus. Interacts with, and mediates the nuclear export of HIV-1 Rev and HTLV-1 Rex proteins. Involved in HTLV-1 Rex multimerization.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. Not expressed in the kidney.
  • Sequence similarities

    Belongs to the exportin family.
    Contains 10 HEAT repeats.
    Contains 1 importin N-terminal domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus > nucleoplasm. Nucleus > Cajal body. Nucleus > nucleolus. Located in the nucleoplasm, Cajal bodies and nucleoli. Shuttles between the nucleus/nucleolus and the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chromosome region maintenance 1 protein homolog antibody
    • CRM 1 antibody
    • CRM1 homolog antibody
    • DKFZp686B1823 antibody
    • emb antibody
    • Exp 1 antibody
    • Exp1 antibody
    • Exportin 1 antibody
    • Exportin-1 antibody
    • Exportin1 antibody
    • XPO 1 antibody
    • xpo1 antibody
    • XPO1_HUMAN antibody
    see all

Images

  • All lanes : Anti-CRM1 antibody (ab231965) at 1 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate
    Lane 3 : Human lung lysate
    Lane 4 : Pig intestine lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/20000 dilution
  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for CRM1 using ab231965 at 20 µg/mLin ICC/IF.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for CRM1 using ab231965 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for CRM1 using ab231965 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CRM1 using ab231965 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-CRM1 antibody (ab231965) at 1 µg/ml + Recombinant human CRM1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

References

ab231965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up